top of page

CircRNA

Gene

chr14|70166638|70168484|—|1|circRNA|SLC8A3|ENST00000356921.6|2

SLC8A3

Open Reading Frame (ORF)

MVFEQRLVAQGTCQAQGRTMSPVQGHRTARRVSSCQSGTRRTLPLGTRLPGSLSILWP

Peptide

TMSPVQGHR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page