top of page

CircRNA

Gene

chr14|67805453|67807920|-|3|circRNA|ZFYVE26|ENST00000347230.8|7,6,5

ZFYVE26

CircRNA UID

circZFYVE26(7,6,5).A

Open Reading Frame (ORF)

LRRMTVLASVTGLCRMHWWTSFERHCGLCRALIRCPLG

Peptide

HCGLCRALIR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page