top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|64208757|64214470|+|6|circRNA|SYNE2|NM_015180|101,102,103,104,105,106

SYNE2

Open Reading Frame (ORF)

MKRRPLRMKQTWKTPEKSRLILGVNGERARNRHLLSPCVI

Peptide

LILGVNGER

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page