top of page

CircRNA

Gene

chr14|60808324|60879835|+|3|circRNA|MNAT1|NM_001177963|4,5,6

MNAT1

CircRNA UID

circMNAT1(4,5,6).A

Open Reading Frame (ORF)

LAPIHKLEEALYEYQPLQIETYGPHVPELEMLGRLGFQLDQQCGFGQHQKENGDIPKGKQRCYSEK

Peptide

LGFQLDQQCGFGQHQK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page