top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|55673012|55675828|+|1|ciRNA|KTN1|NM_001079522|39

KTN1

Open Reading Frame (ORF)

LSFPLWASRTVSKVPMGGKQKQLPYENKKKVFWEQYSSFSLLIFNWKIREAALYIRIGVTELSVLTDWVIHRYIVKHFLMV

Peptide

IGVTELSVLTDWVIHR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page