top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|55612018|55679685|+|42|circRNA|KTN1|NM_001079521|2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43

KTN1

Open Reading Frame (ORF)

MSVSLNQTVTQLQQLLQAVNQQLTKEKEHYQVLGFIGSH

Peptide

EHYQVLGFIGSH

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page