top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|55158521|55189180|-|13|circRNA|DLGAP5|ENST00000395425.6|14,13,12,11,10,9,8,7,6,5,4,3,2

DLGAP5

Open Reading Frame (ORF)

MRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFSGCLHHILPVDTGRI

Peptide

LFSGCLHHILPVDTGR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page