top of page

CircRNA

Gene

chr14|55151694|55154806|-|3|circRNA|DLGAP5|ENST00000395425.6|17,16,15

DLGAP5

Open Reading Frame (ORF)

LSLLKALLKDLEHLSLSTKLYLRVEMRWAFHNKLHHQKMPVLRIRKVNM

Peptide

DLEHLSLSTKLYLR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page