top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|55137391|55138040|+|1|ciRNA|LGALS3|ENST00000553493.5|2

LGALS3

Open Reading Frame (ORF)

LRGFPWTHLSNEGLQAGALFFQQQIWEESQAERGLGLTHSNPFTKRPRAEGSGLCRQELRNPLSSGKCGTVWAF

Peptide

AEGSGLCRQELR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page