top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|54702061|54702580|+|1|circRNA|SAMD4A|ENST00000554335.5|3

SAMD4A

Open Reading Frame (ORF)

LVARTEAAQTLWIMDRHTTITKDRTLMTSSMGGRTLGILGFASMPPTGRTKAWGVRMAMCPSTPPHLSPPQSIRLEPAQVQESLTNGNRNPRIK

Peptide

TLMTSSMGGRTLGILGFASMPPTGR

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page