top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|45175070|45176976|+|1|circRNA|FANCM|NM_001308133|13

FANCM

Open Reading Frame (ORF)

LERTIMMLITVTSQYCPLIKMKVCCYLKMLIQSSTM

Peptide

MLIQSSTM

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page