top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|45173054|45189362|+|8|circRNA|FANCM|NM_001308133|12,13,14,15,16,17,18,19

FANCM

Open Reading Frame (ORF)

MKSSLPHHPSLLLIHRKTVENFQFHRRLKNQPLEFINSLSLNGDCGKIILCLHIKLITQIDAAIL

Peptide

LKNQPLEFINSLSLNGDCGK

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page