top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|35775005|35775745|-|2|circRNA|RALGAPA1|ENST00000389698.7|3,2

RALGAPA1

Open Reading Frame (ORF)

LDAILFIFERMQNLLILNSFSTNIFHIYTMCSLKIL

Peptide

LDAILFIFER

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page