top of page

CircRNA

Gene

chr14|35748584|35756908|-|4|circRNA|RALGAPA1|ENST00000389698.7|10,9,8,7

RALGAPA1

CircRNA UID

circRALGAPA1(10,9,8,7)

Open Reading Frame (ORF)

MIMLIKQTELQNPNSLIPIQALSRSENLAHLVSVVLMKNISQTLK

Peptide

SENLAHLVSVVLMKNISQTLK

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page