top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|35122951|35180777|+|3|circRNA|RP11-561B11.2|NM_001256678|2,3,4

RP11-561B11.2

Open Reading Frame (ORF)

LMLSLMVSMLPKCFLKFVNLNLFMNWNVRGTRGFLLCPLVCGLRRWTSPDCCLIEKTHLPSCF

Peptide

LMLSLMVSMLPK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page