top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|34826012|34862322|-|2|circRNA|BAZ1A|ENST00000358716.8|4,3

BAZ1A

Open Reading Frame (ORF)

MVLLMDMLTVWMEKLLSSVIVMIQKHKAVLFKMVTFLNEPFCATALCGVVL

Peptide

LLSSVIVMIQK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page