top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|34758703|34771659|—|5|circRNA|BAZ1A|ENST00000358716.8|24,23,22,21,20

BAZ1A

Open Reading Frame (ORF)

LGRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQTFGDKNRNSKYCINKCKYTTISEQCGSLSGNGTLSNRAGH

Peptide

YTTISEQCGSLSGNGTLSNR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page