top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|31168297|31205957|-|9|circRNA|HECTD1|NM_015382|10,9,8,7,6,5,4,3,2

HECTD1

Open Reading Frame (ORF)

MCPVNKGDDKKKKDTNKDEEECNEPKGDPEMAPIYLKRLLPVFAQTFQQTMLPSISKETFKKPWQMWTQIHCWNGYRWDREMKGTCN

Peptide

KPWQMWTQIHCWNGYRWDR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page