top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|23061083|23064485|—|8|circRNA|ACIN1|ENST00000557515.5|11,10,9,8,7,6,5,4

ACIN1

Open Reading Frame (ORF)

LLDDLFRKTKAAPCIYWLPLTDSQLPRGCQLETVTQRGASLVGNDAGEPAQPPHRRNLPSVSPLNH

Peptide

AAPCIYWLPLTDSQLPR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

true

bottom of page