top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|20343123|20343277|—|1|rescued|ENST00000554988|ENST00000554988|154|0

ENST00000554988

Open Reading Frame (ORF)

LGRRCRGPRPSGRGPADASFAGAWNRLTASEVSSMAEVR

Peptide

GPADASFAGAWNRLTASEVSSMAEVR

ORF Found in Long-Read

true

Peptide Length

26

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

26

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Rescued

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page