top of page

CircRNA

Gene

chr14|105217543|105217800|-|1|circRNA|BRF1|NM_145685|11

BRF1

Open Reading Frame (ORF)

MLEQKKISSKINYSVLRGLSSAGGGSPHREDAQPEHSASARKLSRRRTPASRSGADPVTSVGKSPRSLASDGSQFRPVPPGRPSRRCWSRRRSPARSIIACSGASAAPAGAVRTGRMHSPSIAPVPGSCHEGGRRPAEVGLTL

Peptide

SIIACSGASAAPAGAVR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page