top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|103673013|103673431|+|2|circRNA|RP11—73M18.2|ENST00000472726.2|11,12

RP11-73M18.2

Open Reading Frame (ORF)

LKQGKFKQAETLYKEILTRAHEREFGSVDGFGEGSPRCCQAVK

Peptide

EFGSVDGFGEGSPR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page