top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|102886188|102897401|+|4|circRNA|TRAF3|ENST00000560371.5|6,7,8,9

TRAF3

Open Reading Frame (ORF)

LKLKLRDKRKCFEIMNPKSFIYRNTKTPTVPAWWCPALTSAASRLS

Peptide

CFEIMNPK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page