top of page

CircRNA

Gene

chr14|102376649|102408619|+|3|circRNA|TECPR2|NM_001172631|2,3,4

TECPR2

Open Reading Frame (ORF)

LAWSPNGMKLFSGDDKGKIVYSSLDLDQPPGFPR

Peptide

GKIVYSSLDLDQPPGFPR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page