top of page

CircRNA

Gene

chr14|102325984|102326887|+|1|circRNA|ZNF839|ENST00000558850.5|2

ZNF839

CircRNA UID

circZNF839(2)

Open Reading Frame (ORF)

LCQGNVWRNKRSGKANAPTDHNPAPNCKKEPAAPGEFLPGGAPYRQPSAAQGTAACENRATVLLPK

Peptide

ANAPTDHNPAPNCK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page