top of page

CircRNA

Gene

chr14|102004517|102006170|+|4|circRNA|DYNC1H1|ENST00000360184.8|24,25,26,27

DYNC1H1

CircRNA UID

circDYNC1H1(24,25,26,27)

Open Reading Frame (ORF)

LVHQRDVTRSLIKSKIDNAKSFEWLSQMRFYFDPKQTDVLQQLSIQMANAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPFGSILWVMKICLKSLETARMSLNYRNTSRRCLLEFRASS

Peptide

CYLTMTQALEARLGGSPFGSILWVMK

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page