top of page

CircRNA

Gene

chr14|101985686|101988852|+|3|circRNA|DYNC1H1|ENST00000360184.8|8,9,10

DYNC1H1

Open Reading Frame (ORF)

LDKLKIKQKLTWTQMLHKLVTSLVESQRSKSRQLHNRIKERSLNPKI

Peptide

SRQLHNR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page