top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|99554303|99555647|+|2|circRNA|TM9SF2|NM_004800|14,15

TM9SF2

Open Reading Frame (ORF)

LASYFWCLSFWLLPVLKQLYFFAISTYVQRPLNTQFEPIRFHVRFLNSRSTRSPCLVLSWEGFCPLAASLYNFSSF

Peptide

FLNSRSTR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page