top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|95161188|95207925|—|13|circRNA|ABCC4|ENST00000376887.8|19,18,17,16,15,14,13,12,11,10,9,8,7

ABCC4

Open Reading Frame (ORF)

LVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGVKLQLSRMPGSGP

Peptide

APVLFFDRNPIGVK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page