top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|77206652|77217957|-|4|circRNA|MYCBP2|ENST00000544440.6|24,23,22,21

MYCBP2

Open Reading Frame (ORF)

LWCYNAVVADARLPSAADMQSRCSILSPELALPTGSRALTTRSHAALHILGDVPLLFKHCQALAHKSLQAATIRQYF

Peptide

HCQALAHK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page