top of page

CircRNA

Gene

chr13|77174310|77243160|-|21|circRNA|MYCBP2|ENST00000544440.6|37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22,21,20,19,18,17

MYCBP2

CircRNA UID

circMYCBP2(37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22,21,20,19,18,17)

Open Reading Frame (ORF)

LRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTRGQIPQILYYSCPSARG

Peptide

GQIPQILYYSCPSAR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page