top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|77139195|77140943|-|3|circRNA|MYCBP2|ENST00000544440.6|52,51,50

MYCBP2

Open Reading Frame (ORF)

MVTLKPGASLLINILARVFWSLLTCWSGSKSKRPTKRDDTTRNSVGQTKV

Peptide

DDTTRNSVGQTK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

true

bottom of page