top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|75795400|75823873|+|11|circRNA|LMO7|ENST00000357063.7|6,7,8,9,10,11,12,13,14,15,16

LMO7

Open Reading Frame (ORF)

MMLGSIMEMLKTLRELQTMWSAPLHQARTQANWLQAYLARKR

Peptide

MMLGSIMEMLK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page