top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|51957515|51975168|-|8|circRNA|ATP7B|NM_000053|9,8,7,6,5,4,3,2

ATP7B

Open Reading Frame (ORF)

LPSNWGHGLRGQHCRRKGSLLALKVLACPGGCGQAPGGGHDLPVLCQLH

Peptide

GSLLALK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page