top of page

CircRNA

Gene

chr13|51374207|51376174|—|3|circRNA|INTS6|NM_001039937|16,15,14

INTS6

Open Reading Frame (ORF)

MKQMNLWLDLKININDPENQICKGSLKDVGVCLHY

Peptide

DVGVCLHY

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page