top of page

CircRNA

Gene

chr13|47948939|47968733|-|5|circRNA|SUCLA2|ENST00000378654.7|10,9,8,7,6

SUCLA2

CircRNA UID

circSUCLA2(10,9,8,7,6)

Open Reading Frame (ORF)

LLVMTWMKLLECLHRRWDFHLILWNQQQKTWSSFTAFF

Peptide

LLVMTWMK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page