top of page

CircRNA

Gene

chr13|45970361|45989097|—|5|circRNA|ZC3H13|ENST00000242848.8|13,12,11,10,9

ZC3H13

Open Reading Frame (ORF)

MKGVPALDSPRSAGVNILRTVMPTTVEMIKVYFPSRTASFSYIF

Peptide

GVPALDSPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page