top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|42187048|42190525|+|3|circRNA|DGKH|ENST00000379274.6|15,16,17

DGKH

Open Reading Frame (ORF)

MTRQFTPVNQLISPLIMTAQKQMNLRRKLKMMVPKNQ

Peptide

LKMMVPK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page