top of page

CircRNA

Gene

chr13|42187048|42189309|+|2|circRNA|DGKH|ENST00000379274.6|15,16

DGKH

Open Reading Frame (ORF)

LRLFSLASALSLWKKMLWNRPVKSPWVKAKSSLGMTLQNLPPRKPSNQGKSCCGQIV

Peptide

AKSSLGMTLQNLPPR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page