top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|41318805|41320824|+|2|circRNA|NAA16|NM_001110798|3,4

NAA16

Open Reading Frame (ORF)

LQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQIQMRDLEGYRRLWL

Peptide

DLEGYRR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page