top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|41252644|41263484|-|7|circRNA|MTRF1|ENST00000379477.5|7,6,5,4,3,2,1

MTRF1

Open Reading Frame (ORF)

LYCLFMESLHILSYTAWFARAAAPRAVASDLPTLRTFPKASE

Peptide

AVASDLPTLR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page