top of page

CircRNA

Gene

chr13|41240260|41260915|-|5|circRNA|MTRF1|ENST00000379480.8|6,5,4,3,2

MTRF1

Open Reading Frame (ORF)

MRVGFTEFSASPRWACPQGCSAFTQERCRLLSFLSQMRC

Peptide

LLSFLSQMR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page