top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|29024456|29034125|+|2|circRNA|MTUS2|ENST00000612955.4|3,4

MTUS2

Open Reading Frame (ORF)

MPIKSCWRSAPLMTSPRHVTWEMKLEIQIQVSQKTVPISIRNFTNFRALGKALRLALPA

Peptide

TVPISIR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page