top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|24905345|24910086|—|4|circRNA|CENPJ|NM_018451|7,6,5,4

CENPJ

Open Reading Frame (ORF)

LRIERGASAAERIAHKSVMIRGLLRTPGPKKIKGEMLIWICLIKITVAMSLSWKA

Peptide

GLLRTPGPK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page