top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|24490667|24498229|—|5|circRNA|PARP4|ENST00000381989.3|10,9,8,7,6

PARP4

Open Reading Frame (ORF)

LSMLNRILKNFSGLEKRFCRIITGGNGGRPGSCGGGASVFAGLQGLSFPDILTLPPG

Peptide

NFSGLEK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page