top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|24475471|24478276|—|3|circRNA|PARP4|ENST00000381989.3|15,14,13

PARP4

Open Reading Frame (ORF)

LVPLEDVHIKGRIIDTVAQYKYQVLTPGRDRWHQTPAHL

Peptide

IIDTVAQYK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page