top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|24222818|24251862|+|3|circRNA|SPATA13|NM_001286792|4,5,6

SPATA13

Open Reading Frame (ORF)

MPAHQVPPYKAVSARFRPFTFSQSTPIGLDRVGRRRQMRASNARGHPGARCARQV

Peptide

ASNARGHPGAR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page