top of page

CircRNA

Gene

chr13|20574379|20592404|+|6|circRNA|IFT88|ENST00000351808.9|2,3,4,5,6,7

IFT88

Open Reading Frame (ORF)

LHLTPLVSQGALLPLWKPRKKIGTNDAKCAPGSRDR

Peptide

IGTNDAKCAPGSR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page