top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|19835476|19852190|—|3|circRNA|ZMYM5|ENST00000535942.5|5,4,3

ZMYM5

Open Reading Frame (ORF)

LCSNHCFNKYRLANGLIMNCCEHCGEYMPSKSTGNNILVIGGQQKRFCCQSCINEYKQVHWHGKMFSGRIRVD

Peptide

FCCQSCINEYKQVHWHGK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page