top of page

CircRNA

Gene

chr13|112556051|112569259|-|5|circRNA|TUBGCP3|ENST00000261965.7|6,5,4,3,2

TUBGCP3

CircRNA UID

circTUBGCP3(6,5,4,3,2)

Open Reading Frame (ORF)

LPSTAVGVTTRMDFNCKSAFFTSHYLKRCPQCCVSQHDKVQERRGYGC

Peptide

LPSTAVGVTTR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page